PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma146g00340.1
Common NameZOSMA_146G00340
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family MIKC_MADS
Protein Properties Length: 172aa    MW: 19763.6 Da    PI: 9.4082
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma146g00340.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF84.56.2e-27959151
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                      krie+ +nrqvtf kR+ngi+KKA ELSvLC+++va+iifs +gk+y y+s
  Zosma146g00340.1  9 KRIESATNRQVTFNKRKNGIIKKAGELSVLCGVDVALIIFSASGKMYYYCS 59
                      79***********************************************96 PP

2K-box25.46.1e-10861363989
             K-box  39 lGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqe 89 
                        GedL+sL++ +Lq+Le++L+k+  + R+k+ + l ++ ++l    ++++ 
  Zosma146g00340.1  86 EGEDLQSLEIAHLQRLEDALQKGQIHAREKQGKALEMEHKQLVDHWQNQEL 136
                       6**********************************9999888665544443 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004326.3E-38160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006630.053161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.44E-31289IPR002100Transcription factor, MADS-box
CDDcd002657.51E-37281No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-26323IPR002100Transcription factor, MADS-box
PfamPF003194.8E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-263859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010093Biological Processspecification of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MGRGKIEIKR IESATNRQVT FNKRKNGIIK KAGELSVLCG VDVALIIFSA SGKMYYYCSN  60
DEMGLTGILL KYHKSAETRL WDAKHEGEDL QSLEIAHLQR LEDALQKGQI HAREKQGKAL  120
EMEHKQLVDH WQNQELRKQH GYQHHQREFA PLQVPLCFRG QPIQPNLHEN K*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S2e-19177174Myocyte-specific enhancer factor 2B
1tqe_R2e-19177174Myocyte-specific enhancer factor 2B
1tqe_Q2e-19177174Myocyte-specific enhancer factor 2B
1tqe_P2e-19177174Myocyte-specific enhancer factor 2B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00080ChIP-seqTransfer from AT5G20240Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009358735.17e-47PREDICTED: floral homeotic protein PMADS 2
SwissprotQ034162e-43GLOB_TOBAC; Floral homeotic protein GLOBOSA
TrEMBLA0A0K9PX901e-126A0A0K9PX90_Z
STRINGGSMUA_Achr5P01230_0011e-45(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP34343877
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20240.12e-38MIKC_MADS family protein